Name | MAT1A antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-1172 |
Prices | $275.00 |
Sizes | 100 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | IHC WB |
Species Reactivities | Human, Mouse, Rat, Dog, C. elegans, Drosophila |
Antigen | MAT1A antibody was raised using the N terminal of MAT1A corresponding to a region with amino acids TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE |
Purity/Format | Total IgG Protein A purified |
Blocking Peptide | MAT1A Blocking Peptide |
Description | Rabbit polyclonal MAT1A antibody raised against the N terminal of MAT1A |
Gene | MAT1A |
Supplier Page | Shop |