| Name | Tetraspanin 8 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7247 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Tetraspanin 8 antibody was raised using the middle region of TSPAN8 corresponding to a region with amino acids VFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNG |
| Purity/Format | Affinity purified |
| Blocking Peptide | Tetraspanin 8 Blocking Peptide |
| Description | Rabbit polyclonal Tetraspanin 8 antibody raised against the middle region of TSPAN8 |
| Gene | TSPAN8 |
| Supplier Page | Shop |