| Name | SGCE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6701 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SGCE antibody was raised using the N terminal of SGCE corresponding to a region with amino acids TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDPI |
| Purity/Format | Affinity purified |
| Blocking Peptide | SGCE Blocking Peptide |
| Description | Rabbit polyclonal SGCE antibody raised against the N terminal of SGCE |
| Gene | SGCE |
| Supplier Page | Shop |