Claudin 18 antibody

Name Claudin 18 antibody
Supplier Fitzgerald
Catalog 70R-6157
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Claudin 18 antibody was raised using the middle region of CLDN18 corresponding to a region with amino acids YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY
Purity/Format Affinity purified
Blocking Peptide Claudin 18 Blocking Peptide
Description Rabbit polyclonal Claudin 18 antibody raised against the middle region of CLDN18
Gene CLDN18
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.