| Name | TXNDC15 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7440 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TXNDC15 antibody was raised using the C terminal of TXNDC15 corresponding to a region with amino acids STRFGTVAVPNILLFQGAKPMARFNHTDRTLETLKIFIFNQTGIEAKKNV |
| Purity/Format | Affinity purified |
| Blocking Peptide | TXNDC15 Blocking Peptide |
| Description | Rabbit polyclonal TXNDC15 antibody raised against the C terminal of TXNDC15 |
| Gene | TXNDC15 |
| Supplier Page | Shop |