FAM82A antibody

Name FAM82A antibody
Supplier Fitzgerald
Catalog 70R-3583
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen FAM82A antibody was raised using the middle region of Fam82A corresponding to a region with amino acids RAPMNGHCHLWYAVLCGYVSEFEGLQNKINYGHLFKEHLDIAIKLLPEEP
Purity/Format Affinity purified
Blocking Peptide FAM82A Blocking Peptide
Description Rabbit polyclonal FAM82A antibody raised against the middle region of Fam82A
Gene RMDN2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.