| Name | KIF3A antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5601 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Dog |
| Antigen | KIF3A antibody was raised using the C terminal of KIF3A corresponding to a region with amino acids PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR |
| Purity/Format | Affinity purified |
| Blocking Peptide | KIF3A Blocking Peptide |
| Description | Rabbit polyclonal KIF3A antibody raised against the C terminal of KIF3A |
| Gene | KIF3A |
| Supplier Page | Shop |