| Name | ZDHHC24 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7087 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ZDHHC24 antibody was raised using the middle region of ZDHHC24 corresponding to a region with amino acids QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTA |
| Purity/Format | Affinity purified |
| Blocking Peptide | ZDHHC24 Blocking Peptide |
| Description | Rabbit polyclonal ZDHHC24 antibody raised against the middle region of ZDHHC24 |
| Gene | ZDHHC24 |
| Supplier Page | Shop |