ERAL1 antibody

Name ERAL1 antibody
Supplier Fitzgerald
Catalog 70R-4863
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen ERAL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLM
Purity/Format Affinity purified
Blocking Peptide ERAL1 Blocking Peptide
Description Rabbit polyclonal ERAL1 antibody
Gene ERAL1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.