KLHDC8B antibody

Name KLHDC8B antibody
Supplier Fitzgerald
Catalog 70R-3775
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen KLHDC8B antibody was raised using the middle region of KLHDC8B corresponding to a region with amino acids AMAEGSVFSLGGLQQPGPHNFYSRPHFVNTVEMFDLEHGSWTKLPRSLRM
Purity/Format Affinity purified
Blocking Peptide KLHDC8B Blocking Peptide
Description Rabbit polyclonal KLHDC8B antibody raised against the middle region of KLHDC8B
Gene KLHDC8B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.