Carbonic Anhydrase IV antibody

• Supplier: Fitzgerald
• Catalog: 70R-7279
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Carbonic Anhydrase IV antibody was raised using the C terminal of CA4 corresponding to a region with amino acids AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
• Purity/Format: Affinity purified
• Blocking Peptide: Carbonic Anhydrase IV Blocking Peptide
• Description: Rabbit polyclonal Carbonic Anhydrase IV antibody raised against the C terminal of CA4
• Gene: CA4