RP11-269F19.9 antibody

• Supplier: Fitzgerald
• Catalog: 70R-3967
• Prices: $345.00
• Sizes: 50 µg
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: RP11-269F19.9 antibody was raised using the middle region of RP11-269F19.9 corresponding to a region with amino acids VCSVVLGPRAGQGVHVVSRALWDVARDGLASVSYTNTSLFAVATVHGLYC
• Purity/Format: Affinity purified
• Blocking Peptide: RP11-269F19.9 Blocking Peptide
• Description: Rabbit polyclonal RP11-269F19.9 antibody raised against the middle region of RP11-269F19.9
• Gene: TCTEX1D4