ARL8A antibody

Name ARL8A antibody
Supplier Fitzgerald
Catalog 70R-5793
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen ARL8A antibody was raised using the middle region of ARL8A corresponding to a region with amino acids IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQ
Purity/Format Affinity purified
Blocking Peptide ARL8A Blocking Peptide
Description Rabbit polyclonal ARL8A antibody raised against the middle region of ARL8A
Gene ARL8A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.