ADAT1 antibody

Name ADAT1 antibody
Supplier Fitzgerald
Catalog 70R-4703
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications IHC WB
Species Reactivities Human
Antigen ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV
Purity/Format Affinity purified
Blocking Peptide ADAT1 Blocking Peptide
Description Rabbit polyclonal ADAT1 antibody raised against the C terminal of ADAT1
Gene ADAT1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.