| Name | GLYATL2 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2525 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GLYATL2 antibody was raised using the middle region of GLYATL2 corresponding to a region with amino acids LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK |
| Purity/Format | Affinity purified |
| Blocking Peptide | GLYATL2 Blocking Peptide |
| Description | Rabbit polyclonal GLYATL2 antibody raised against the middle region of GLYATL2 |
| Gene | GLYATL2 |
| Supplier Page | Shop |