| Name | C2ORF55 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4287 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C2ORF55 antibody was raised using the middle region of C2Orf55 corresponding to a region with amino acids ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF |
| Purity/Format | Affinity purified |
| Blocking Peptide | C2ORF55 Blocking Peptide |
| Description | Rabbit polyclonal C2ORF55 antibody raised against the middle region of C2Orf55 |
| Gene | KIAA1211L |
| Supplier Page | Shop |