| Name | BMPER antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5473 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | BMPER antibody was raised using the C terminal of BMPER corresponding to a region with amino acids NGHKRDDLIGGDGNFKFDVDDFAESWRVESNEFCNRPQRKPVPELCQGTV |
| Purity/Format | Affinity purified |
| Blocking Peptide | BMPER Blocking Peptide |
| Description | Rabbit polyclonal BMPER antibody raised against the C terminal of BMPER |
| Gene | BMPER |
| Supplier Page | Shop |