CRABP2 antibody

Name CRABP2 antibody
Supplier Fitzgerald
Catalog 70R-2749
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen CRABP2 antibody was raised using the middle region of CRABP2 corresponding to a region with amino acids FEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI
Purity/Format Affinity purified
Blocking Peptide CRABP2 Blocking Peptide
Description Rabbit polyclonal CRABP2 antibody raised against the middle region of CRABP2
Gene CRABP2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.