SLC16A6 antibody

Name SLC16A6 antibody
Supplier Fitzgerald
Catalog 70R-6797
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SLC16A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA
Purity/Format Affinity purified
Blocking Peptide SLC16A6 Blocking Peptide
Description Rabbit polyclonal SLC16A6 antibody
Gene SLC16A6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.