| Name | C20ORF10 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5857 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C20ORF10 antibody was raised using the N terminal Of C20Orf10 corresponding to a region with amino acids RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN |
| Purity/Format | Affinity purified |
| Blocking Peptide | C20ORF10 Blocking Peptide |
| Description | Rabbit polyclonal C20ORF10 antibody raised against the N terminal Of C20Orf10 |
| Gene | TP53TG5 |
| Supplier Page | Shop |