| Name | GSG1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7536 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | GSG1 antibody was raised using the C terminal of GSG1 corresponding to a region with amino acids VLEFKCKHSKSFKENPNCLPHHHQCFPRRLSSAAPTVGPLTSYHQYHNQP |
| Purity/Format | Affinity purified |
| Blocking Peptide | GSG1 Blocking Peptide |
| Description | Rabbit polyclonal GSG1 antibody raised against the C terminal of GSG1 |
| Gene | GSG1 |
| Supplier Page | Shop |