| Name | IGFBP7 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5313 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | IGFBP7 antibody was raised using the C terminal of IGFBP7 corresponding to a region with amino acids RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH |
| Purity/Format | Affinity purified |
| Blocking Peptide | IGFBP7 Blocking Peptide |
| Description | Rabbit polyclonal IGFBP7 antibody raised against the C terminal of IGFBP7 |
| Gene | IGFBP7 |
| Supplier Page | Shop |