| Name | CEACAM16 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6445 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | CEACAM16 antibody was raised using the middle region of CEACAM16 corresponding to a region with amino acids LLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAW |
| Purity/Format | Affinity purified |
| Blocking Peptide | CEACAM16 Blocking Peptide |
| Description | Rabbit polyclonal CEACAM16 antibody raised against the middle region of CEACAM16 |
| Gene | CEACAM16 |
| Supplier Page | Shop |