| Name | PAPOLB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4959 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PAPOLB antibody was raised using the N terminal of PAPOLB corresponding to a region with amino acids TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK |
| Purity/Format | Affinity purified |
| Blocking Peptide | PAPOLB Blocking Peptide |
| Description | Rabbit polyclonal PAPOLB antibody raised against the N terminal of PAPOLB |
| Gene | PAPOLB |
| Supplier Page | Shop |