| Name | CLCNKA antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5151 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | CLCNKA antibody was raised using the N terminal of CLCNKA corresponding to a region with amino acids MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW |
| Purity/Format | Affinity purified |
| Blocking Peptide | CLCNKA Blocking Peptide |
| Description | Rabbit polyclonal CLCNKA antibody raised against the N terminal of CLCNKA |
| Gene | CLCNKA |
| Supplier Page | Shop |