| Name | RBM9 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5890 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RBM9 antibody was raised using the middle region of RBM9 corresponding to a region with amino acids PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT |
| Purity/Format | Affinity purified |
| Blocking Peptide | RBM9 Blocking Peptide |
| Description | Rabbit polyclonal RBM9 antibody raised against the middle region of RBM9 |
| Gene | RBFOX2 |
| Supplier Page | Shop |