Name | MAOB antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-6477 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | MAOB antibody was raised using the N terminal of MAOB corresponding to a region with amino acids RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV |
Purity/Format | Affinity purified |
Blocking Peptide | MAOB Blocking Peptide |
Description | Rabbit polyclonal MAOB antibody raised against the N terminal of MAOB |
Gene | MAOB |
Supplier Page | Shop |