| Name | C1ORF92 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3711 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | C1ORF92 antibody was raised using the middle region of C1Orf92 corresponding to a region with amino acids VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDAT |
| Purity/Format | Affinity purified |
| Blocking Peptide | C1ORF92 Blocking Peptide |
| Description | Rabbit polyclonal C1ORF92 antibody raised against the middle region of C1Orf92 |
| Gene | LRRC71 |
| Supplier Page | Shop |