C1ORF92 antibody

Name C1ORF92 antibody
Supplier Fitzgerald
Catalog 70R-3711
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen C1ORF92 antibody was raised using the middle region of C1Orf92 corresponding to a region with amino acids VDKTDKTQTMKTPKGLGKKKEKSWELAKKEEKLGSGQSPTQGTPKKEDAT
Purity/Format Affinity purified
Blocking Peptide C1ORF92 Blocking Peptide
Description Rabbit polyclonal C1ORF92 antibody raised against the middle region of C1Orf92
Gene LRRC71
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.