GRIK2 antibody

Name GRIK2 antibody
Supplier Fitzgerald
Catalog 70R-1530
Prices $275.00
Sizes 100 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Dog
Antigen GRIK2 antibody was raised using the N terminal of GRIK2 corresponding to a region with amino acids LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLP
Purity/Format Total IgG Protein A purified
Blocking Peptide GRIK2 Blocking Peptide
Description Rabbit polyclonal GRIK2 antibody raised against the N terminal of GRIK2
Gene GRIK5
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.