| Name | HCG_1745121 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3903 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | HCG_1745121 antibody was raised using the N terminal Of Hcg_1745121 corresponding to a region with amino acids MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKP |
| Purity/Format | Affinity purified |
| Blocking Peptide | HCG_1745121 Blocking Peptide |
| Description | Rabbit polyclonal HCG_1745121 antibody raised against the N terminal Of Hcg_1745121 |
| Gene | ISPD |
| Supplier Page | Shop |