RSPRY1 antibody

Name RSPRY1 antibody
Supplier Fitzgerald
Catalog 70R-2813
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen RSPRY1 antibody was raised using the N terminal of RSPRY1 corresponding to a region with amino acids RSQPRDPVRPPRRGRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPY
Purity/Format Affinity purified
Blocking Peptide RSPRY1 Blocking Peptide
Description Rabbit polyclonal RSPRY1 antibody raised against the N terminal of RSPRY1
Gene RSPRY1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.