RER1 antibody

Name RER1 antibody
Supplier Fitzgerald
Catalog 70R-6861
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen RER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF
Purity/Format Affinity purified
Blocking Peptide RER1 Blocking Peptide
Description Rabbit polyclonal RER1 antibody
Gene RER1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.