| Name | TMEM104 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1724 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TMEM104 antibody was raised using the middle region of TMEM104 corresponding to a region with amino acids GDLAIYAAAVPFSLMQVTCSATGNDSCGVEADTKYNDTDRCWGPLRRVDA |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | TMEM104 Blocking Peptide |
| Description | Rabbit polyclonal TMEM104 antibody raised against the middle region of TMEM104 |
| Gene | TMEM104 |
| Supplier Page | Shop |