| Name | RARB antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1916 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | RARB antibody was raised using the C terminal of RARB corresponding to a region with amino acids SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPS |
| Purity/Format | Affinity purified |
| Blocking Peptide | RARB Blocking Peptide |
| Description | Rabbit polyclonal RARB antibody raised against the C terminal of RARB |
| Gene | RARB |
| Supplier Page | Shop |