| Name | TGDS antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4004 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | TGDS antibody was raised using the middle region of TGDS corresponding to a region with amino acids DEVYGGSLDKEFDESSPKQPTNPYASSKAAAECFVQSYWEQYKFPVVITR |
| Purity/Format | Affinity purified |
| Blocking Peptide | TGDS Blocking Peptide |
| Description | Rabbit polyclonal TGDS antibody raised against the middle region of TGDS |
| Gene | TGDS |
| Supplier Page | Shop |