| Name | MGC34821 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4292 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MGC34821 antibody was raised using the middle region of Mgc34821 corresponding to a region with amino acids VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF |
| Purity/Format | Affinity purified |
| Blocking Peptide | MGC34821 Blocking Peptide |
| Description | Rabbit polyclonal MGC34821 antibody raised against the middle region of Mgc34821 |
| Gene | SLC22A24 |
| Supplier Page | Shop |