| Name | NLGN4X antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-6162 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | NLGN4X antibody was raised using the N terminal of NLGN4X corresponding to a region with amino acids SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEEN |
| Purity/Format | Affinity purified |
| Blocking Peptide | NLGN4X Blocking Peptide |
| Description | Rabbit polyclonal NLGN4X antibody raised against the N terminal of NLGN4X |
| Gene | NLGN4X |
| Supplier Page | Shop |