| Name | C8ORF34 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4132 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C8ORF34 antibody was raised using the N terminal Of C8Orf34 corresponding to a region with amino acids MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK |
| Purity/Format | Affinity purified |
| Blocking Peptide | C8ORF34 Blocking Peptide |
| Description | Rabbit polyclonal C8ORF34 antibody raised against the N terminal Of C8Orf34 |
| Gene | C8orf34 |
| Supplier Page | Shop |