| Name | SLC38A4 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-1214 |
| Prices | $275.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog, C. elegans, Drosophila, Zebrafish |
| Antigen | SLC38A4 antibody was raised using the middle region of SLC38A4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV |
| Purity/Format | Total IgG Protein A purified |
| Blocking Peptide | SLC38A4 Blocking Peptide |
| Description | Rabbit polyclonal SLC38A4 antibody raised against the middle region of SLC38A4 |
| Gene | SLC38A4 |
| Supplier Page | Shop |