| Name | PPM1M antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3588 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PPM1M antibody was raised using the middle region of PPM1M corresponding to a region with amino acids VYPELLAGEFTRLEFPRRLKGDDLGQKVLFRDHHMSGWSYKRVEKSDLKY |
| Purity/Format | Affinity purified |
| Blocking Peptide | PPM1M Blocking Peptide |
| Description | Rabbit polyclonal PPM1M antibody raised against the middle region of PPM1M |
| Gene | PPM1M |
| Supplier Page | Shop |