Name | GNL3L antibody |
---|---|
Supplier | Fitzgerald |
Catalog | 70R-3042 |
Prices | $345.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | GNL3L antibody was raised using a synthetic peptide corresponding to a region with amino acids MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN |
Purity/Format | Affinity purified |
Blocking Peptide | GNL3L Blocking Peptide |
Description | Rabbit polyclonal GNL3L antibody |
Gene | GNL3L |
Supplier Page | Shop |