MTRF1L antibody

Name MTRF1L antibody
Supplier Fitzgerald
Catalog 70R-2498
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen MTRF1L antibody was raised using the N terminal of MTRF1L corresponding to a region with amino acids ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL
Purity/Format Affinity purified
Blocking Peptide MTRF1L Blocking Peptide
Description Rabbit polyclonal MTRF1L antibody raised against the N terminal of MTRF1L
Gene MTRF1L
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.