| Name | MTRF1L antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2498 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MTRF1L antibody was raised using the N terminal of MTRF1L corresponding to a region with amino acids ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL |
| Purity/Format | Affinity purified |
| Blocking Peptide | MTRF1L Blocking Peptide |
| Description | Rabbit polyclonal MTRF1L antibody raised against the N terminal of MTRF1L |
| Gene | MTRF1L |
| Supplier Page | Shop |