| Name | PREP antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4324 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | PREP antibody was raised using the middle region of PREP corresponding to a region with amino acids LHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDM |
| Purity/Format | Affinity purified |
| Blocking Peptide | PREP Blocking Peptide |
| Description | Rabbit polyclonal PREP antibody raised against the middle region of PREP |
| Gene | PREP |
| Supplier Page | Shop |