FAM76A antibody

Name FAM76A antibody
Supplier Fitzgerald
Catalog 70R-3780
Prices $345.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen FAM76A antibody was raised using the middle region of FAM76A corresponding to a region with amino acids QCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQE
Purity/Format Affinity purified
Blocking Peptide FAM76A Blocking Peptide
Description Rabbit polyclonal FAM76A antibody raised against the middle region of FAM76A
Gene FAM76A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.