| Name | GDE1 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-7477 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | GDE1 antibody was raised using the N terminal Of Gde1 corresponding to a region with amino acids LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN |
| Purity/Format | Affinity purified |
| Blocking Peptide | GDE1 Blocking Peptide |
| Description | Rabbit polyclonal GDE1 antibody raised against the N terminal Of Gde1 |
| Gene | GDE1 |
| Supplier Page | Shop |