| Name | TTL antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-2530 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | TTL antibody was raised using the middle region of TTL corresponding to a region with amino acids LYREGVLRTASEPYHVDNFQDKTCHLTNHCIQKEYSKNYGKYEEGNEMFF |
| Purity/Format | Affinity purified |
| Blocking Peptide | TTL Blocking Peptide |
| Description | Rabbit polyclonal TTL antibody raised against the middle region of TTL |
| Gene | TTL |
| Supplier Page | Shop |