| Name | C7ORF31 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-3267 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | C7ORF31 antibody was raised using the N terminal Of C7Orf31 corresponding to a region with amino acids EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE |
| Purity/Format | Affinity purified |
| Blocking Peptide | C7ORF31 Blocking Peptide |
| Description | Rabbit polyclonal C7ORF31 antibody raised against the N terminal Of C7Orf31 |
| Gene | C7orf31 |
| Supplier Page | Shop |