| Name | UBXD3 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-4548 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | UBXD3 antibody was raised using the middle region of UBXD3 corresponding to a region with amino acids PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI |
| Purity/Format | Affinity purified |
| Blocking Peptide | UBXD3 Blocking Peptide |
| Description | Rabbit polyclonal UBXD3 antibody raised against the middle region of UBXD3 |
| Gene | UBXN10 |
| Supplier Page | Shop |