| Name | RGS6 antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5830 |
| Prices | $345.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | RGS6 antibody was raised using the C terminal of RGS6 corresponding to a region with amino acids SAINLDSHSYEITSQNVKDGGRYTFEDAQEHIYKLMKSDSYARFLRSNAY |
| Purity/Format | Affinity purified |
| Blocking Peptide | RGS6 Blocking Peptide |
| Description | Rabbit polyclonal RGS6 antibody raised against the C terminal of RGS6 |
| Gene | RGS6 |
| Supplier Page | Shop |