PCOLCE antibody

Name PCOLCE antibody
Supplier Fitzgerald
Catalog 70R-5478
Prices $375.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen PCOLCE antibody was raised using the middle region of PCOLCE corresponding to a region with amino acids LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS
Purity/Format Affinity purified
Blocking Peptide PCOLCE Blocking Peptide
Description Rabbit polyclonal PCOLCE antibody raised against the middle region of PCOLCE
Gene PCOLCE
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.