| Name | PCOLCE antibody |
|---|---|
| Supplier | Fitzgerald |
| Catalog | 70R-5478 |
| Prices | $375.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | PCOLCE antibody was raised using the middle region of PCOLCE corresponding to a region with amino acids LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS |
| Purity/Format | Affinity purified |
| Blocking Peptide | PCOLCE Blocking Peptide |
| Description | Rabbit polyclonal PCOLCE antibody raised against the middle region of PCOLCE |
| Gene | PCOLCE |
| Supplier Page | Shop |